PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011101883.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GRAS
Protein Properties Length: 574aa    MW: 64351.8 Da    PI: 4.7536
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011101883.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS451.84.3e-1382065743374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +lLlecA a+++g++e+a+++++ l++++s +g+p +R+aay++eALaar+a s+++ly+al+++e++   sse+l+a+++++ev+P+++f+++t
  XP_011101883.1 206 SLLLECAAAIHNGNFEEASHMINVLRQRVSIQGEPSERIAAYMVEALAARIATSGKGLYRALKCKEQP---SSERLSAMQVLFEVCPCFRFGFMT 297
                     79*****************************************************************9...9*********************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN aIlea e e+rvHiiDfd++qG Q+ +Llq+La+ p++ p++R+Tgv++pes+      l+ +g+rL+++Ae l+++fef++ va +++ ++
  XP_011101883.1 298 ANGAILEACEDEKRVHIIDFDVNQGSQYYTLLQTLAKSPGKRPHVRLTGVDDPESVqrAVGGLKIIGRRLEQLAEDLQLSFEFDA-VAAETALVS 391
                     ******************************************************99878889***********************.7999***** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     +++L+++pgEa++Vn+++qlh+++desvs+ + rd++L++vksl+Pk+v+vveq++++n+++Fl rf+ea +yysa+f+sl+a+lpr+s++r++v
  XP_011101883.1 392 PSMLDCQPGEAVVVNFAFQLHHMPDESVSTVNLRDQLLRMVKSLKPKLVTVVEQDVNTNTAPFLSRFAEAYNYYSAVFESLDATLPRDSQDRMNV 486
                     *********************************************************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     E+++l+r+i nvvaceg+er+er e ++kWr+r+++aGF+p p+s++ + +++ l+ +++++ y+v+ee g+l +gW+d+ L++ SaWr
  XP_011101883.1 487 EKQCLARDIINVVACEGEERIERYEVAGKWRARMSMAGFSPCPISQNLNIEIRKLITQYSDR-YKVKEETGALHFGWEDKILIVSSAWR 574
                     ************************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.09178555IPR005202Transcription factor GRAS
PfamPF035141.5E-135206574IPR005202Transcription factor GRAS
Gene3DG3DSA:3.40.50.1502.6E-4338530IPR029063S-adenosyl-L-methionine-dependent methyltransferase
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MSLVRSAALF RNREVYSRKD GNDSSGVSTS IFNTDNRGII YSSESYSSDS YDPKYFLDSP  60
SDDLVHTSGS DASENPFHQP RASSYQLMAG NGSLTSSLAT KRHNAYEFNY ESEYFDSQSP  120
DAIDYDESKM RLKLQELEKA LLDDNATNDD DSDNHEHSME IDGEWSDTTR YPLLYNSPKE  180
SSSSDSILSS TSSTKEISFT TLTPKSLLLE CAAAIHNGNF EEASHMINVL RQRVSIQGEP  240
SERIAAYMVE ALAARIATSG KGLYRALKCK EQPSSERLSA MQVLFEVCPC FRFGFMTANG  300
AILEACEDEK RVHIIDFDVN QGSQYYTLLQ TLAKSPGKRP HVRLTGVDDP ESVQRAVGGL  360
KIIGRRLEQL AEDLQLSFEF DAVAAETALV SPSMLDCQPG EAVVVNFAFQ LHHMPDESVS  420
TVNLRDQLLR MVKSLKPKLV TVVEQDVNTN TAPFLSRFAE AYNYYSAVFE SLDATLPRDS  480
QDRMNVEKQC LARDIINVVA CEGEERIERY EVAGKWRARM SMAGFSPCPI SQNLNIEIRK  540
LITQYSDRYK VKEETGALHF GWEDKILIVS SAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-602085748375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101883.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101887.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101891.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101898.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A068UU850.0A0A068UU85_COFCA; Uncharacterized protein
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1